Comparison

Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27001-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
MICA
Alternative Names
MHC Class I Polypeptide-Related Sequence A, MIC-A, MICA, PERB11.1
Uniprot
Q29983
Source
Mammalian cell
Expression Region
23-308aa
AA Sequence
AEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFL RCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGN GKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNST RSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLA MNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKS GVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYP WNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTW VATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLV LQSHWQ
Sequence Info
Partial
Tag Info
C-terminal FC-tagged
Theoretical MW
59.9 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human N2DL2 in functional ELISA is less than 5 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
MHC class I polypeptide-related sequence A, also known as MIC-A, PERB11.1 and MICA, is a single-pass type I membrane protein which belongs to the MHC class I family of MIC subfamily. MICA contains one Ig-like C1-type domain and is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by NK cells, NKT cells, and most of the subtypes of T cells. MICA is the ligand for NK cell activating receptor KLRK1/NKG2D. MICA seems to have no role in antigen presentation. MICA leads to cell lysis by binding to KLRK1.
Function
Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis.
Involvement in disease
Psoriasis 1 (PSORS1); Psoriatic arthritis (PSORAS)
Subcellular location
Cell membrane, Single-pass type I membrane protein, Cytoplasm
Protein Families
MHC class I family, MIC subfamily
Tissue Specificity
Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassal's corpuscles within the medulla of normal thymus. In skin, expressed mainly in the keratin layers, basal cells, ducts and follicles. Also expressed in many, but not all, epithelial tumors of lung, breast, kidney, ovary, prostate and colon. In thyomas, overexpressed in cortical and medullar epithelial cells. Tumors expressing MICA display increased levels of gamma delta T-cells.
Paythway
Naturalkillercellmediatedcytotoxicity

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close