Comparison

Recombinant Human Nectin-4 (NECTIN4), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27003-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
NECTIN4
Alternative Names
PVRL4, Nectin-4, Ig superfamily receptor LNIR, Poliovirus receptor-related protein 4, PRR4, LNIR
Uniprot
Q96NY8
Source
Mammalian cell
Expression Region
31-351aa
AA Sequence
AGELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQV AWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQ PPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAG SFQARLRLRVLVPPLPSLNPGPALEEGQGLTLAAS CTAEGSPAPSVTWDTEVKGTTSSRSFKHSRSAAVT SEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHIL HVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQ PPPSYNWTRLDGPLPSGVRVDGDTLGFPPLTTEHS GIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDL VSASVV
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
35.3 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Specific activity as determined by the ability of the immobilized protein to support the adhesion of NIH?3T3 mouse embryonic fibroblast cells is greater than 40%. When 5 x 10^4 cells/well are added to plates coated with recombinant human Nectin-4 (1 ug/mL with 100 uL/well), approximately >68.8% will adhere after 40 min incubation at 37 CC.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Nectin-4 (PVRL4) is a type I transmembrane glycoprotein which belongs to the nectin family of Ig superfamily proteins. It contains two Ig-like C2-type domains and one Ig-like V-type domain. PVRL4 seems to be involved in cell adhesion through trans-homophilic and -heterophilic interactions, the latter including specifically interactions with nectin-1. It does not act as receptor for alpha-herpesvirus entry into cells. It is predominantly expressed in placenta, the embryo and breast carcinoma. But it is not detected in normal breast epithelium. The soluble form is produced by proteolytic cleavage at the cell surface (shedding), probably by ADAM17. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder.
Function
Seems to be involved in cell adhesion through trans-homophilic and -heterophilic interactions, the latter including specifically interactions with NECTIN1. Does not act as receptor for alpha-herpesvirus entry into cells.; FUNCTION
Involvement in disease
Ectodermal dysplasia-syndactyly syndrome 1 (EDSS1)
Subcellular location
Cell membrane, Single-pass type I membrane protein, Cell junction, adherens junction, Note=Colocalizes with AFDN at cadherin-based adherens junctions (PubMed:11544254), SUBCELLULAR LOCATION: Processed poliovirus receptor-related protein 4: Secreted
Protein Families
Nectin family
Tissue Specificity
Predominantly expressed in placenta. Not detected in normal breast epithelium but expressed in breast carcinoma.
Paythway
Adherensjunction

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close