Comparison

Recombinant Human Ephrin type-A receptor 2 (EPHA2), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27005-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
EPHA2
Alternative Names
Ephrin type-A receptor 2, Epithelial cell kinase, Tyrosine-protein kinase receptor ECK, EPHA2
Uniprot
P29317
Source
Mammalian cell
Expression Region
24-534aa
AA Sequence
AQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNI MNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAER IFIELKFTVRDCNSFPGGASSCKETFNLYYAESDL DYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKL NVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYY KKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDH AVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEK VEDACQACSPGFFKFEASESPCLECPEHTLPSPEG ATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAV GMGAKVELRWTPPQDSGGREDIVYSVTCEQCWPES GECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNY TFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVR LEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGD SNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQE GQGAGSKVHEFQTLSPEGSGN
Sequence Info
Partial
Tag Info
C-terminal FC-tagged
Theoretical MW
83 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human Ephrin-A1 in functional ELISA is less than 25 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Ephrin type-A receptor 2/EphA2 is a member of the Eph receptor tyrosine kinase family which binds Ephrins A1, 2, 3, 4, and 5. A and B class Eph proteins have a common structural organization. Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. EphA2 becomes autophosphorylated following ligand binding and then interacts with SH2 domain-containing PI3-kinase to activate MAPK pathways. Reverse signaling is also propagated through the Ephrin ligand. Transcription of EphA2 is dependent on the expression of E-Cadherin, and can be induced by p53 family transcription factors. EphA2 is upregulated in breast, prostate, and colon cancer vascular endothelium. Its ligand, EphrinA1, is expressed by the local tumor cells. In some cases, EphA2 and EphrinA1 are expressed on the same blood vessels. EphA2 signaling cooperates with VEGF receptor signaling in promoting endothelial cell migration.
Function
Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Activated by the ligand ephrin-A1/EFNA1 regulates migration, integrin-mediated adhesion, proliferation and differentiation of cells. Regulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibition of the ERK1/ERK2 (MAPK3/MAPK1, respectively) signaling pathway. May also participate in UV radiation-induced apoptosis and have a ligand-independent stimulatory effect on chemotactic cell migration. During development, may function in distinctive aspects of pattern formation and subsequently in development of several fetal tissues. Involved for instance in angiogenesis, in early hindbrain development and epithelial proliferation and branching morphogenesis during mammary gland development. Engaged by the ligand ephrin-A5/EFNA5 may regulate lens fiber cells shape and interactions and be important for lens transparency development and maintenance. With ephrin-A2/EFNA2 may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis.
Involvement in disease
Cataract 6, multiple types (CTRCT6)
Subcellular location
Cell membrane, Single-pass type I membrane protein, Cell projection, ruffle membrane, Single-pass type I membrane protein, Cell projection, lamellipodium membrane, Single-pass type I membrane protein, Cell junction, focal adhesion
Protein Families
Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily
Tissue Specificity
Expressed in brain and glioma tissue and glioma cell lines (at protein level). Expressed most highly in tissues that contain a high proportion of epithelial cells, e.g. skin, intestine, lung, and ovary.
Paythway
MAPKsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close