Comparison

Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27006-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
KLRK1
Alternative Names
CD314, KLRK1, CD314 antigen, Killer cell lectin-like receptor subfamily K member 1, killer cell lectin-like receptor subfamily K, member 1, KLR, NK cell receptor D, NKG2-D, NKG2-D type II integral membrane protein, NKG2-D-activating NK receptor,
Uniprot
P26718
Source
Mammalian cell
Expression Region
78-216aa
AA Sequence
FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQ FFDESKNWYESQASCMSQNASLLKVYSKEDQDLLK LVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTII EMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
Theoretical MW
16.9 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind its antibody in a functional ELISA is less than 10 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
NKG2-D type II integral membrane protein (NKG2D) is a type II transmembrane glycoprotein which belongs to the CD94/NKG2 family. NKG2D is expressed on natural killer (NK) cells, CD8+ alpha-beta and gamma-delta T-cells. As an activating and costimulatory receptor, it involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. It provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. It stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. NKG2D participates in NK cell-mediated bone marrow graft rejection and survival of NK cells. It Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.
Function
Function as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.
Subcellular location
Cell membrane, Single-pass type II membrane protein
Tissue Specificity
Expressed in natural killer (NK) cells, CD8(+) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs).

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close