Comparison

Recombinant Human Arginase-1 (ARG1) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27007-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
ARG1
Alternative Names
Arginase-1, Liver-type arginase, Type I arginase, ARG1
Uniprot
P05089
Source
Mammalian cell
Expression Region
1-322aa
AA Sequence
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAG LLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNP RSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAI GSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNL HGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIV YIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGK VMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATG TPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNP SLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPI DYLNPPK
Sequence Info
Full Length
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
35.6 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
0.2 um filtered 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, 1 mM DTT, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 30000 pmol/min/ug.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
ARG1 is a member of the ureohydrolase family of enzymes. ARG1 can catalyze the hydrolysis of arginine to ornithine and urea. In the urea cycle, ARG1 catalyzes the fifth and final step, a series of biochemical reactions in mammals during which the body disposes of harmful ammonia. ARG1 is a cytosolic enzyme and expressed widely in the liver as part of the urea cycle, while it is also expressed in cells and tissues that lack a complete urea cycle, including lung. Inherited deficiency of this ARG1 causes argininemia, which is an autosomal recessive disorder characterized by hyperammonemia.
Function
Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.
Involvement in disease
Argininemia (ARGIN)
Subcellular location
Cytoplasm, Cytoplasmic granule
Protein Families
Arginase family
Tissue Specificity
Within the immune system initially reported to be selectively expressed in granulocytes (polymorphonuclear leukocytes [PMNs]) (PubMed:15546957). Also detected in macrophages mycobacterial granulomas (PubMed:23749634). Expressed in group2 innate lymphoid cells (ILC2s) during lung disease (PubMed:27043409).

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close