Comparison

Recombinant Human Parathyroid hormone (PTH) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27008-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
PTH
Alternative Names
Parathyroid Hormone, PTH, Parathormone, Parathyrin
Uniprot
P01270
Source
E.coli
Expression Region
32-115aa
AA Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFV ALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEA DKADVNVLTKAKSQ
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
9 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um Filtered 10 mM HAc-NaAc, 150 mM NaCl, 5% Mannitol, pH 4.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to induce cAMP accumulation in MC3T3?E1 mouse preosteoblast cells is less than 0.1 ug/ml
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor as parathyroid hormone and has major effects on development. Like most other protein hormones, parathyroid hormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packaged within the Golgi into secretory vesicles, the secreted into blood by exocytosis. Parathyroid hormone is secreted as a linear protein of 84 amino acids.
Function
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
Involvement in disease
Hypoparathyroidism, familial isolated (FIH)
Subcellular location
Secreted
Protein Families
Parathyroid hormone family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close