Comparison

Recombinant Human Carbonic anhydrase 4 (CA4), partial (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27009-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
CA4
Alternative Names
Carbonic Anhydrase 4, Carbonate Dehydratase IV, Carbonic Anhydrase IV, CA-IV, CA4
Uniprot
P22748
Source
E.coli
Expression Region
19-283aa
AA Sequence
AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSP INIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGH SVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPY KGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQD PEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKP EMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPT CDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQT VSMKDNVRPLQQLGQRTVIK
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
31.43 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
0.2 um filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.5
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The esterase activity is determined to be greater than 500 pmol/min/ug
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Carbonic Anhydrase 4 (CA4) belongs to the alpha-carbonic anhydrase family. Alpha-carbonic anhydrase is a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. Carbonic anhydrase 4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Carbonic anhydrase 4 may stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It may have a role in inherited renal abnormalities of bicarbonate transport. Furthermore, Carbonic anhydrase 4 is essential for acid overload removal from the retina and retina epithelium and acid release in the choriocapillaris.
Function
Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It is essential for acid overload removal from the retina and retina epithelium, and acid release in the choriocapillaris in the choroid.
Involvement in disease
Retinitis pigmentosa 17 (RP17)
Subcellular location
Cell membrane, Lipid-anchor, GPI-anchor
Protein Families
Alpha-carbonic anhydrase family
Tissue Specificity
Expressed in the endothelium of the choriocapillaris in eyes (at protein level). Not expressed in the retinal epithelium at detectable levels.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close