Comparison

Recombinant Human Malate dehydrogenase, cytoplasmic (MDH1) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27011-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
MDH1
Alternative Names
Malate Dehydrogenase Cytoplasmic, Cytosolic Malate Dehydrogenase, Diiodophenylpyruvate Reductase, MDH1, MDHA
Uniprot
P40925
Source
E.coli
Expression Region
2-334aa
AA Sequence
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPI ILVLLDITPMMGVLDGVLMELQDCALPLLKDVIAT DKEDVAFKDLDVAILVGSMPRREGMERKDLLKANV KIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTAS KSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTAN DVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYE ALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSA AKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVP DDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLT AKELTEEKESAFEFLSSA
Sequence Info
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
37.5 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
0.2 um filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Its dehydrogenation activity from (S)-malate to oxaloacetate in the presense of NAD+ is determined to be greater than 1000 pmol/min/ug
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Malate Dehydrogenase, Cytoplasmic (MDH1) is an enzyme which belongs to the MDH Type 2 sub-family of LDH/MDH superfamily. MDH1 is involved in the Citric Acid Cycle that catalyzes the conversion of Malate into Oxaloacetate (using NAD+) and vice versa. MDH1 should not be confused with Malic Enzyme, which catalyzes the conversion of Malate to Pyruvate, producing NADPH. MDH1 also participates in Gluconeogenesis, the synthesis of Glucose from smaller molecules. Pyruvate in the mitochondria is acted upon by Pyruvate Carboxylase to form Pxaloacetate, a Citric Acid Cycle intermediate. In order to transport the Oxaloacetate out of the Mitochondria, Malate Dehydrogenase reduces it to Malate, and it then traverses the inner Mitochondrial membrane. Once in the cytosol, the Malate is oxidized back to Oxaloacetate by MDH1. Finally, Phosphoenol-Pyruvate Carboxy Kinase (PEPCK) converts Oxaloacetate to Phosphoenol Pyruvate.
Subcellular location
Cytoplasm
Protein Families
LDH/MDH superfamily, MDH type 2 family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close