Comparison

Recombinant Human Cathepsin E (CTSE) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27012-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
CTSE
Alternative Names
Cathepsin E, CTSE
Uniprot
P14091
Source
Mammalian cell
Expression Region
20-396aa
AA Sequence
SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMI QFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQ NFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQ SSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLT VVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAV GGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGS ELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQ VGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQN AIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTL SPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWI LGDVFIRQFYSVFDRGNNRVGLAPAVP
Sequence Info
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
41.78 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um Filtered 20 mM MES, 150 mM NaCl, pH 5.5
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Specific activity as determined by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2 is greater than 1500 pmol/min/ug
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Cathepsin E (CTSE) is a gastric aspartyl protease that functions as a disulfide-linked homodimer. It is a member of the Peptidase C1 family, and has a specificity similar to that of Pepsin A and Cathepsin D. CTSE is localized to the endoplasmic reticulum and Golgi apparatus, while the mature enzyme is localized to the endosome. It is expressed abundantly in the stomach, the Clara cells of the lung and activated B-lymphocytes, and at lower levels in lymph nodes, skin and spleen. CTSE is an intracellular proteinase that have a role in immune function, activation-induced lymphocyte depletion in the thymus, neuronal degeneration and glial cell activation in the brain. Futhermore, it probably involved in the processing of antigenic peptides during MHC class II-mediated antigen presentation.
Function
May have a role in immune function. Probably involved in the processing of antigenic peptides during MHC class II-mediated antigen presentation. May play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degeneration and glial cell activation in the brain.
Subcellular location
Endosome
Protein Families
Peptidase A1 family
Tissue Specificity
Expressed abundantly in the stomach, the Clara cells of the lung and activated B-lymphocytes, and at lower levels in lymph nodes, skin and spleen. Not expressed in resting B-lymphocytes.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close