Comparison

Recombinant Human Angiotensin-converting enzyme 2 (ACE2), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27013-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
ACE2
Alternative Names
Angiotensin-Converting Enzyme 2, ACE-Related Carboxypeptidase, Angiotensin-Converting Enzyme Homolog, ACEH, Metalloprotease MPROT15, ACE2
Uniprot
Q9BYF1
Source
Mammalian cell
Expression Region
18-740aa
AA Sequence
QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNT NITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQE IQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNT MSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLD YNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMAR ANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVE HTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCL PAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAM VDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSM LTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMD DFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHE AVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEIN FLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQ WMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVS NDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKC DISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAK NMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSP YADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSV AYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFN FFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRL NDNSLEFLGIQPTLGPPNQPPVS
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
84.63 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
0.2 um filtered 20 mM Tris-HCl, 150 mM NaCl, 0.1 mM ZnCl2, 10% Glycerol, pH 7.5
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Specific activity as determined by its ability to cleave a fluorogenic peptide substrate, Mca-YVADAPK(Dnp)-OH is greater than 800 pmol/min/ug.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Angiotensin-Converting Enzyme 2 (ACE-2) is an integral membrane protein and a zinc metalloprotease of the ACE family, the ACE family includes somatic and germinal ACE. ACE-2 cleaves angiotensins I and II as a carboxypeptidase, ACE-2 converts angiotensin I to angiotensin 1-9, and angiotensin II to angiotensin 1-7. ACE-2 is also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency. ACE-2 can be high expressed in testis, kidney and heart, in colon, small intestine and ovary at moderate levels. Captopril and lisinopril as the classical ACE inhibitor don´t inhibit ACE-2 activity. ACE-2 may play an important role in regulating the heart function.
Function
Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency. May be an important regulator of heart function.
Subcellular location
Processed angiotensin-converting enzyme 2: Secreted, SUBCELLULAR LOCATION: Cell membrane, Single-pass type I membrane protein, Cytoplasm
Protein Families
Peptidase M2 family
Tissue Specificity
Expressed in endothelial cells from small and large arteries, and in arterial smooth muscle cells. Expressed in lung alveolar epithelial cells, enterocytes of the small intestine, Leydig cells and Sertoli cells (at protein level). Expressed in heart, kidney, testis, and gastrointestinal system.
Paythway
Renin-angiotensinsystem

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close