Comparison

Recombinant Human Ephrin type-A receptor 4 (EPHA4), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27014-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
EPHA4
Alternative Names
Ephrin type-A receptor 4, HEK8, SEK, TYRO1, EPHA4, Tyrosine-protein kinase receptor SEK, Tyrosine-protein kinase TYRO1, EK8, hEK8, EPH-like kinase 8
Uniprot
P54764
Source
Mammalian cell
Expression Region
20-547aa
AA Sequence
VTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGW EEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWI TREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNL YYYESDNDKERFIRENQFVKIDTIAADESFTQVDI GDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIAL VSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEV RGSCVNNSEEKDVPKMYCGADGEWLVPIGNCLCNA GHEERSGECQACKIGYYKALSTDATCAKCPPHSYS VWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLN LISNVNETSVNLEWSSPQNTGGRQDISYNVVCKKC GAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLL AHTNYTFEIWAVNGVSKYNPNPDQSVSVTVTTNQA APSSIALVQAKEVTRYSVALAWLEPDRPNGVILEY EVKYYEKDQNERSYRIVRTAARNTDIKGLNPLTSY VFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGA NST
Sequence Info
Partial
Tag Info
C-terminal FC-tagged
Theoretical MW
85.6 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to binding recombinant human Ephrin-A5 used funtional ELISA is 66.8nM when EphA4 2ug/ml in a solid phases.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Ephrin type-A receptor 4(EPHA4) belongs to the protein kinase superfamily and Ephrin receptor subfamily. EPHA4 contains 1 Eph LBD domain, 2 fibronectin type-III domains, 1 protein kinase domain and 1 SAM domain. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
Function
Receptor tyrosine kinase which binds membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous, it has the unique property among Eph receptors to bind and to be physiologically activated by both GPI-anchored ephrin-A and transmembrane ephrin-B ligands including EFNA1 and EFNB3. Upon activation by ephrin ligands, modulates cell morphology and integrin-dependent cell adhesion through regulation of the Rac, Rap and Rho GTPases activity. Plays an important role in the development of the nervous system controlling different steps of axonal guidance including the establishment of the corticospinal projections. May also control the segregation of motor and sensory axons during neuromuscular circuit development. In addition to its role in axonal guidance plays a role in synaptic plasticity. Activated by EFNA1 phosphorylates CDK5 at 'Tyr-15' which in turn phosphorylates NGEF regulating RHOA and dendritic spine morphogenesis. In the nervous system, plays also a role in repair after injury preventing axonal regeneration and in angiogenesis playing a role in central nervous system vascular formation. Additionally, its promiscuity makes it available to participate in a variety of cell-cell signaling regulating for instance the development of the thymic epithelium.
Subcellular location
Cell membrane, Single-pass type I membrane protein, Cell projection, axon, Cell projection, dendrite, Cell junction, synapse, postsynaptic cell membrane, postsynaptic density, Early endosome
Protein Families
Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily
Tissue Specificity
Ubiquitous.
Paythway
Inhibitorsofaxonalregeneration

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close