Comparison

Recombinant Human GDNF family receptor alpha-1 (GFRA1) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27015-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
GFRA1
Alternative Names
GDNF Family Receptor Alpha-1, GDNF Receptor Alpha-1, GDNFR-Alpha-1, GFR-Alpha-1, RET Ligand 1, TGF-Beta-Related Neurotrophic Factor Receptor 1, GFRA1, GDNFRA, RETL1, TRNR1
Uniprot
P56159
Source
Mammalian cell
Expression Region
25-429aa
AA Sequence
DRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETN FSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMK KEKNCLRIYWSMYQSLQGNDLLEDSPYEPVNSRLS DIFRVVPFISDVFQQVEHIPKGNNCLDAAKACNLD DICKKYRSAYITPCTTSVSNDVCNRRKCHKALRQF FDKVPAKHSYGMLFCSCRDIACTERRRQTIVPVCS YEEREKPNCLNLQDSCKTNYICRSRLADFFTNCQP ESRSVSSCLKENYADCLLAYSGLIGTVMTPNYIDS SSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK NAIQAFGNGSDVTVWQPAFPVQTTTATTTTALRVK NKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSG NTHLCISNGNYEKEGLGASS
Sequence Info
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
46.28 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human GDNF in functional ELISA is less than 10 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Glial Cell Line-Derived Neurotrophic Factor Family Receptor alpha-1 (GDNFRalpha1) is a glycosylphosphatidylinositol (GPI) linked cell surface protein belonging to GDNF-family receptor alpha subtype which consists of at least four members. GFRalpha1and GFRalpha2 are the cognate co-receptor for the neurotrophic factor neurturin mediating the NRTN-induced autophosphorylation and activation of the RET tyrosine kinase receptor. Soluble GFRalphas released enzymatically from the cell surface by phosphatidylinositol phospholipase C, as well as recombinantly produced soluble GFRalpha1, can also bind with high affinity to GDNF and trigger the activation of Ret tyrosine kinase. Human GFRalpha1 shares 93% amino acid identity with mouse GFRalpha1.The expression of the various GFRalphas are differentially regulated in the central and peripheral nervous system, suggesting complementary roles for the GFRalphas in mediating the activities of the GDNF family of neurotrophic factors.
Function
Receptor for GDNF. Mediates the GDNF-induced autophosphorylation and activation of the RET receptor (By similarity).
Subcellular location
Cell membrane, Lipid-anchor, GPI-anchor
Protein Families
GDNFR family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close