Comparison

Recombinant Human Ephrin-A1 (EFNA1) (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27017-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
EFNA1
Alternative Names
Ephrin-A1, EPH-Related Receptor Tyrosine Kinase Ligand 1, LERK-1, Immediate Early Response Protein B61, Tumor Necrosis Factor Alpha-Induced Protein 4, TNF Alpha-Induced Protein 4, EFNA1, EPLG1, LERK1, TNFAIP4
Uniprot
P20827
Source
Mammalian cell
Expression Region
19-182aa
AA Sequence
DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPH YEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQV RWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEG HSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAH DNPQEKRLAADDPEVRVLHSIGHS
Sequence Info
Full Length of Mature Protein
Tag Info
C-terminal FC-tagged
Theoretical MW
46.5 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human EphA2 in functional ELISA is less than 10 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Ephrin-A1 is a member of the A-type ephrin family of cell surface proteins that function as ligands for the A-type Eph receptor tyrosine kinase family. Ephrin-A1 can be induced by TNF and IL1B. Its expression levels can be down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells. Soluble Ephrin-A1 is necessary for the transformation of HeLa and SK-BR3 cells and participates in the relocalization of EPHA2 away from sites of cell-cell contact during transformation. Ephrin-A1 plays an important role in angiogenesis and tumor neovascularization.
Function
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis.
Subcellular location
Cell membrane, Lipid-anchor, GPI-anchor, SUBCELLULAR LOCATION: Ephrin-A1, secreted form: Secreted
Protein Families
Ephrin family
Tissue Specificity
Brain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level).
Paythway
MAPKsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close