Comparison

Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27019-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
NRG1
Alternative Names
Pro-neuregulin-1, Neuregulin-1 beta 1, NRG1-beta 1, HRG1-beta 1, EGF, NRG1, GGF, HGL, HRGA, NDF, SMDF,
Uniprot
Q02297-6
Source
E.coli
Expression Region
177-241aa
AA Sequence
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCK CPNEFTGDRCQNYVMASFYKHLGIEFMEAE
Sequence Info
Partial of Isoform 6
Tag Info
Tag-Free
Theoretical MW
7.5 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a serum-free cell proliferation assay using MCF?7 human breast cancer cells is less than 3 ng/mL.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
neuregulin-1 (heregulin-1, NRG1) is a member of neuregulin family, which is comprised of four genes that encode a large number of secreted or membrane-bound isoforms. All family members share an EGF-like domain that interacts with the ErbB family of tyrosine kinase receptors. NRG1 isoforms can be classified into type I, type II and type III isoforms. NRG1 directs ligand for ERBB3 and ERBB4 tyrosine kinase receptors, concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG proteins show distinct spatial and temporal expression patterns and play important roles during development of both the nervous system and the heart.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close