Comparison

Recombinant Human Fibronectin (FN1), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27021-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
FN1
Alternative Names
NovoNectin, Fibronectin, FN, Cold-insoluble globulin, CIG, FN, Fibronectin 1
Uniprot
P02751
Source
E.coli
Expression Region
1270-1546aa & 1721-2016aa
AA Sequence
PTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSP VKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVS SVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSF TVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHS RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQ STVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYR ITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDY TITVYAVTGRGDSPASSKPISINYRTEIDKPS & AIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVR VTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEV SVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDA TETTITIS WRTKTETITGFQVDAVPANGQTPIQR TIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSP VVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRAR ITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLE PGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVT LPHPNLHGPEILDVPST
Sequence Info
Dimer
Tag Info
Tag-Free
Theoretical MW
62.7 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um Filtered 12.5 mM Sodium Citrate, 1.25% Sucrose, pH 6.2
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Specific activity as determined by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells is greater than 50%. When 1x10^5 cells/well are added to plates coated with fibronectin (7-13 ng/mL and 100uL/well), approximately 50%-80% will adhere specifically after 30 minutes at 37C.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Fibronectin1(FN1) is a secreted protein and contains 12 fibronectin type-I domains, fibronectin type-II domains and 16 fibronectin type-III domains.Recombinant human fibronectin fragment, is a protein of ca.63 kDa containing a central cell-binding domain, a high affinity heparin-binding domain II, and CS1 site within the alternatively spliced III CS region of human fibronectin. Cells bind to a VLA-4 ligand, a CS-I site, and a VLA-5 ligand, a cell attachment domain, and virus vectors binds to a heparin binding domain II, which co-locates the cell and the virus vector on NovoNectin. This process enhances the density of both cells and vectors, and facilitates the gene transduction in the result.
Function
Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. Participates in the regulation of type I collagen deposition by osteoblasts.; FUNCTION
Involvement in disease
Glomerulopathy with fibronectin deposits 2 (GFND2)
Subcellular location
Secreted, extracellular space, extracellular matrix
Tissue Specificity
Plasma FN (soluble dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. Ugl-Y1, Ugl-Y2 and Ugl-Y3 are found in urine.
Paythway
PI3K-Aktsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close