Comparison

Recombinant Mouse Fibroblast growth factor 2 (Fgf2) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 1mg
Item no. BM-RPC26852-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Fgf2
Alternative Names
Fibroblast Growth Factor 2, FGF-2, Basic Fibroblast Growth Factor, bFGF, Heparin-Binding Growth Factor 2, HBGF-2, Fgf2, Fgf-2
Uniprot
P15655
Source
E.coli
Expression Region
1-154aa
AA Sequence
MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKN GGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGV VSIKGVCANRYLAMKEDGRLLASKCVTEECFFFER LESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGP GQKAILFLPMSAKS
Sequence Info
Full Length
Tag Info
Tag-Free
Theoretical MW
17.15 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 400 mM NaCl, pH 7.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 2 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
FGF basic is one of 22 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine, and sheep FGF basic. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity. Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis is reminiscent of a variety of pathological conditions.
Function
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis.
Subcellular location
Secreted, Nucleus
Protein Families
Heparin-binding growth factors family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close