Comparison

Recombinant Mouse Transforming growth factor beta-1 (Tgfb1) (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 1mg
Item no. BM-RPC26857-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Tgfb1
Alternative Names
TGF-beta-1, CED, DPD1, TGFB, TGF-b1, TGFB1, CEDLAP, latency-associated peptide, TGFbeta, TGF-beta 1 protein, transforming growth factor beta-1
Uniprot
P04202
Source
Mammalian cell
Expression Region
279-390aa
AA Sequence
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHE PKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNP GASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMI VRSCKCS
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
12.8 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um Filtered 4 mM HCl
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF?1 human erythroleukemic cells is less than 1 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Transforming growth factor beta 1 (TGFbeta1) is the prototype of a growing superfamily of peptide growth factors and plays a prominent role in a variety of cellular processes, including cell-cycle progression, cell differentiation, reproductive function, development, motility, adhesion, neuronal growth, bone morphogenesis, wound healing, and immune surveillance. TGF-beta1, TGF-beta2 and TGF-beta3 signal via the same heteromeric receptor complex, consisting of a ligand binding TGF-beta receptor type II (TbetaR-II), and a TGF-beta receptor type I (TbetaR-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF-beta expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.
Function
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts
Subcellular location
Secreted, extracellular space, extracellular matrix
Protein Families
TGF-beta family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close