Comparison

Recombinant Mouse Fibroblast growth factor 17 (Fgf17) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 1mg
Item no. BM-RPC26858-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Fgf17
Alternative Names
Fibroblast growth factor 17, FGF-17, fgf17
Uniprot
P63075
Source
E.coli
Expression Region
23-216aa
AA Sequence
TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQL YSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDT FGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDC VFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQA SRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEF VGSAPTRRTKRTRRPQSQT
Sequence Info
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
23.7 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 3 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
FGF-17 is a member of the fibroblast growth factor (FGF) family. FGFs share 30 70% amino acid (aa) identity in a conserved, approximately 120 amino acid core domain. FGFs play multiple roles in biological functions, including angiogenesis, mitogenesis, cell differentiation and wound repair. FGF17 plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. It is also expressed in hindgut, parts of the developing skeleton, tail bud, major arteries, and heart. In many of these areas, it is expressed along with FGF-8, but slightly later. It is required for normal brain development.
Function
Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.
Subcellular location
Secreted
Protein Families
Heparin-binding growth factors family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close