Comparison

Recombinant Mouse Fibroblast growth factor 9 (Fgf9) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 1mg
Item no. BM-RPC26859-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Fgf9
Alternative Names
Fibroblast growth factor 9, FGF-9, Glia-activating factor, GAF, heparin-binding growth factor-9, HBGF-9, Fgf9, Fgf-9
Uniprot
P54130
Source
E.coli
Expression Region
1-208aa
AA Sequence
MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSD HLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRT GFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLV SIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQF EENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREG TRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Sequence Info
Full Length
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
24.4 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
0.2 um filtered 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% Glycerol, 1 mM DTT, pH 8.5
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 10 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Fibroblast growth factor-9 (FGF-9) is an approximately 26 kDa secreted glycoprotein of the FGF family. Secreted mouse FGF-9 lacks the N-terminal 1-3 aa and shares >98% sequence identity with rat, human, equine, porcine and bovine FGF-9. FGF-9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. In the mouse embryo the location and timing of FGF-9 expression affects development of the skeleton, cerebellum, lungs, heart, vasculature, digestive tract, and testes .It may have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. Deletion of mouse FGF-9 is lethal at birth due to lung hypoplasia, and causes rhizomelia, or shortening of the proximal skeleton. An unusual constitutive dimerization of FGF 9 buries receptor interaction sites which lowers its activity, and increases heparin affinity which inhibits diffusion. A spontaneous mouse mutant, Eks, interferes with dimerization, resulting monomeric, diffusible FGF-9 that causes elbow and knee synostoses (joint fusions) due to FGF-9 misexpression in developing joints.
Function
Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.
Subcellular location
Secreted
Protein Families
Heparin-binding growth factors family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close