Comparison

Recombinant Mouse Fibroblast growth factor 1 (Fgf1) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 1mg
Item no. BM-RPC26861-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Fgf1
Alternative Names
Fibroblast Growth Factor 1, FGF-1, Acidic Fibroblast Growth Factor, aFGF, Heparin-Binding Growth Factor 1, HBGF-1, Fgf1, Fgf-1, Fgfa
Uniprot
P61148
Source
E.coli
Expression Region
16-155aa
AA Sequence
FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTR DRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTE GLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
15.7 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 500 mM NaCl, pH 6.6
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells in the presence of Heparin is less than 1.6 ng/mL.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
FGF acidic is a 17 kDa nonglycosylated member of the FGF family of mitogenic peptides. FGF acidic, which is produced by multiple cell types, stimulates the proliferation of all cells of mesodermal origin and many cells of neuroectodermal, ectodermal, and endodermal origin. It plays a number of roles in development, regeneration, and angiogenesis. FGF-acidic is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. FGF-acidic has the ability to signal through all the FGF receptors.
Function
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV
Subcellular location
Secreted, Cytoplasm, Cytoplasm, cell cortex, Cytoplasm, cytosol, Nucleus
Protein Families
Heparin-binding growth factors family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close