Comparison

Recombinant Mouse Vascular endothelial growth factor A (Vegfa), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 1mg
Item no. BM-RPC26862-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Vegfa
Alternative Names
Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGFA, VEGFA164, VEGF164
Uniprot
Q00731-2
Source
Yeast
Expression Region
27-190aa
AA Sequence
APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIF QEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPT SESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRP KKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKN TDSRCKARQLELNERTCRCDKPRR
Sequence Info
Partial of Isoform 2
Tag Info
Tag-Free
Theoretical MW
19.27 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using HUVEC human umbilical vein endothelial cells is less than 4ng/mL, corresponding to a specific activity of >= 2.5 x 105 units/mg.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Mouse Vascular endothelial growth factor (VEGF or VEGF-A), is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. It is a member of the PDGF/VEGF growth factor family that is characterized by a cystine knot structure formed by eight conserved cysteine residues. Alternately spliced isoforms of 120, 164 and 188 aa found in mouse. VEGF binds the type I transmembrane receptor tyrosine kinases VEGF R1 (also called Flt-1) and VEGF R2 (Flk-/KDR) on endothelial cells.Although affinity is highest for binding to VEGF R1, VEGF R2 appears to be the primary mediator of VEGF angiogenic activity. VEGF is required during embryogenesis to regulate the proliferation, migration, and survival of endothelial cells.It may play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close