Comparison

Recombinant Mouse Interleukin-4 (Il4), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC26927-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Il4
Alternative Names
Interleukin-4, B-cell IgG differentiation factor, B-cell growth factor 1, B-cell stimulatory factor 1, IGG1 induction factor, Lymphocyte stimulatory factor 1, IL-4, BSF-1
Uniprot
P07750
Source
E.coli
Expression Region
23-140aa
AA Sequence
HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLT ATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNS SVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDF LESLKSIMQMDYS
Sequence Info
Partial
Tag Info
Tag-Free
Theoretical MW
13.4 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using CTLL?2 mouse cytotoxic T cells is less than 2 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Mouse Interleukin-4(IL-4) is a monomeric, Th2 cytokine that shows pleiotropic effects during immune responses. It is a glycosylated polypeptide that contains three intrachain disulfide bridges and adopts a bundled four alpha-helix structure. IL-4 exerts its effects through two receptor complexes, Participates in at least several B-cell activation processes as well as of other cell types. IL-4 is primarily expressed by Th2-biased CD4+T cells, mast cells, basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class switch to IgG1 and IgE in mouse B cells, acquisition of the Th2 phenotype by naïve CD4+T cells, priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and activation of epithelial cells. IL-4 plays a dominant role in the development of allergic inflammation and asthma. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.
Function
Participates in at least several B-cell activation processes as well as of other cell types
Subcellular location
Secreted
Protein Families
IL-4/IL-13 family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close