Comparison

Recombinant Mouse Interleukin-2 (Il2) (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC26928-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Il2
Alternative Names
aldesleukin, interleukin 2, interleukin-2, IL-2, IL2, T-cell growth facter, T cell growth factor, TCGF
Uniprot
P04351
Source
E.coli
Expression Region
21-169aa
AA Sequence
APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDL QELLSRMENYRNLKLPRMLTFKFYLPKQATELKDL QCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIR VTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFC QSIISTSPQ
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
17.4 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um Filtered 20 mM Sodium Citrate, 5% Trehalose, pH 4.5
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using CTLL?2 mouse cytotoxic T cells is less than 0.5 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Interleukin 2 (IL 2), also termed T-cell growth factor, is a member of the cytokine family which includes IL-4, IL-7, IL-9, IL-15 and IL-21. Each member of this family has a four alpha helix bundle. IL-2 signals through the IL-2 receptor, a complex consisting of tree subunits, termed alpha, beta and gamma. The IL-2 R gamma is shared by cytokine receptors of all members of cytokine family. Mature mouse IL-2 shares 56% and 73% aa sequence identity with human and rat IL-2, respectively. IL-2 is produced by CD4+ T cell, CD8+ T cells, gamma delta T cells, B cells, dendritic cells and eosinophils, and plays a vital role in key function of the immune system, tolerance and immunity, primarily via its potent stimulatory activity for T cells.Thus, IL-2 may be a key cytokine in the natural suppression of autoimmunity.
Function
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
Subcellular location
Secreted
Protein Families
IL-2 family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close