Comparison

Recombinant Mouse Interleukin-4 (Il4) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC26929-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Il4
Alternative Names
Interleukin-4, IL-4, IL4, B-cell IgG differentiation factor, B-cell growth factor 1, B-cell stimulatory factor 1, BSF-1, IGG1 induction factor, Lymphocyte stimulatory factor 1
Uniprot
P07750
Source
Mammalian cell
Expression Region
21-140aa
AA Sequence
HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNV LTATKNTTESELVCRASKVLRIFYLKHGKTPCLKK NSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLK DFLESLKSIMQMDYS
Sequence Info
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
14.6 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using CTLL?2 mouse cytotoxic T cells is less than 2 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. IL-4 is produced by mast cells, T cells, and bone marrow stromal cells. IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergic response.
Function
Participates in at least several B-cell activation processes as well as of other cell types
Subcellular location
Secreted
Protein Families
IL-4/IL-13 family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close