Comparison

Recombinant Mouse Interleukin-10 (Il10) (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC26930-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Il10
Alternative Names
Interleukin-10, Il10, IL-10, Cytokine synthesis inhibitory factor, CSIF,
Uniprot
P18893
Source
E.coli
Expression Region
19-178aa
AA Sequence
SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKT FFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQ FYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRL RRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAM NEFDIFINCIEAYMMIKMKS
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
18.9 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by the dose-dependent co-stimulation with murine IL-4 of MC-9 cells is less than 2 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Mouse Il10 is the prototypic member of the IL-10 cytokine family, including IL-10, IL-19, IL-20, IL-22 (IL-TIF), IL-24 and IL-26. Many viruses encode viral members of the IL-10 family, such as Epstein-Barr virus (EBV) and human cytomegalovirus (HCMV).Its main function is inhibiting the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Although human and mouse IL-10 are 81% identical at the nucleotide and amino acid level, mouse IL-10 is species-specific and does not act on human cells. Interestingly, Human IL-10 is active on mouse cells.
Function
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Subcellular location
Secreted
Protein Families
IL-10 family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close