Comparison

Recombinant Mouse Tumor necrosis factor (Tnf), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC26949-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Tnf
Alternative Names
Tumor Necrosis Factor, Cachectin, TNF-Alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, Tumor Necrosis Factor, Membrane Form, Tumor Necrosis Factor, Soluble Form, Tnf, Tnfa, Tnfsf2
Uniprot
P06804
Source
E.coli
Expression Region
89-235aa
AA Sequence
DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLK DNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTV SRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWY EPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQV YFGVIAL
Sequence Info
Partial
Tag Info
Tag-Free
Theoretical MW
16.4 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells is less than 0.08 ng/ml in the presence of the metabolic inhibitor actinomycin D.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Tumor Necrosis Factor (TNF) is a member of the Tumor Necrosis Factor family. TNF exists as a homotrimer and interacts with SPPL2B. TNF is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. TNF is a key cytokine in the development of several inflammatory disorders. It contributes to the development of type 2 diabetes throught its effects on insulin resistance and fatty acid metabolism.
Function
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION
Subcellular location
Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, membrane form: Membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, soluble form: Secreted, SUBCELLULAR LOCATION: C-domain 1: Secreted, SUBCELLULAR LOCATION: C-domain 2: Secreted
Protein Families
Tumor necrosis factor family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close