Comparison

Recombinant Mouse Tumor necrosis factor receptor superfamily member 10B (Tnfrsf10b), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC26950-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Tnfrsf10b
Alternative Names
Tumor necrosis factor receptor superfamily member 10B/Death receptor 5/MK/CD262/Tnfrsf10b/Dr5/Killer
Uniprot
Q9QZM4
Source
Mammalian cell
Expression Region
53-177aa
AA Sequence
NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKP CREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCN ITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEE LTSCTPRENRKCVSKTAWAS
Sequence Info
Partial
Tag Info
C-terminal FC-tagged
Theoretical MW
40.9 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L?929 mouse fibroblast cells treated with TRAIL is less than 1 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Mouse tumor necrosis factor receptor superfamily member 10B (TNFRSF10B) is a member of the TNFR family which contains 1 death domain and 3 TNFR-Cys repeats. TNFRSF10B exhibits high structural and functional homology to TRAIL-R1 (DR-4). TNFRSF10B is highly expressed in heart, lung, lymphocytes, spleen and kidney. In addition, it is regulated by the tumor suppressor p53. TNFRSF10B is the receptor for the cytotoxic ligand TNFSF10/TRAIL. It promotes the activation of NF-kappa-B and is essential for ER stress-induced apoptosis. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases mediating apoptosis.
Function
Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
Subcellular location
Membrane, Single-pass type I membrane protein
Tissue Specificity
Highly expressed in heart, lung and kidney.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close