Comparison

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC26976-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Ctla4
Alternative Names
Cytotoxic T-lymphocyte protein 4, Cytotoxic T-lymphocyte-associated antigen 4, CTLA-4, CD152, Ctla4
Uniprot
P09793
Source
Mammalian cell
Expression Region
37-161aa
AA Sequence
AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRV TVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGT FNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFV GMGNGTQIYVIDPEPCPDSD
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
14.6 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Mouse B7-1 in functional ELISA is less than 20 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Mouse Cytotoxic Tlymphocyte 4(CTLA-4, CD152), is a type I transmembrane T cell inhibitory molecule. mouse CTLA4 cDNA encodes 223 amino acids (aa) including a 35 aa signal sequence, a 126 aa extracellular domain (ECD) with one Ig-like V-type domain, a 21 aa transmembrane (TM) sequence, and a 41 aa cytoplasmic sequence. Within the ECD, Mouse CTLA-4 shares 68% aa sequence identity with human. CTLA4 is similar to the T cell costimulatory protein CD28 since both of the molecules bind to CD80 and CD86 on antigen-presenting cells. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found inregulatory T cells and may play an important role in their functions. T cell activation through the T cell receptor and CD28 leads to increased expression of CTLA4. Genetic variations of CTLA4 have been associated with susceptibility to systemic lupus erythematosus(SLE), Gravesdisease(GRD), Celiac disease type3(CELIAC3) and Hepatitis B virus infection(HBVinfection).
Function
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Subcellular location
Cell membrane, Single-pass type I membrane protein
Tissue Specificity
Widely expressed with highest levels in lymphoid tissues.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close