Comparison

Recombinant Mouse Tumor necrosis factor receptor superfamily member 14 (Tnfrsf14), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC26977-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Tnfrsf14
Alternative Names
Tnfrsf14, Herpesvirus entry mediator, HVEM, TR2, TNF receptor-like molecule, ATAR, another TRAF-associated receptor, Tumor necrosis factor receptor superfamily member 14
Uniprot
Q80WM9
Source
Mammalian cell
Expression Region
39-207aa
AA Sequence
QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGT VCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTW QECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTT CPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEE CLPWTNCSAFQQEVRRGTNSTDTTCSSQV
Sequence Info
Partial
Tag Info
C-terminal FC-tagged
Theoretical MW
45.6 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human BTLA in functional ELISA is typically 1.17 ug/ml
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Mouse Protein Tnfrsf14, is a type I transmembrane protein belonging to the TNF receptor superfamily. It is tumor necrosis factor receptor superfamily member 14 and expressed on the surface of T cells during the resting state. Interaction of HVEM with TNF family member LIGHT co-stimulates T cells and promotes inflammation. HVEM also triggers inhibitory signaling cascade in effector T (Teff) cells and regulatory T cells (Tregs) as a ligand of B and T lymphocyte attenuator. Tnfrsf14 is detected in peripheral blood T cells, B cells, monocytes and in various tissues enriched in lymphoid cells. It has demonstrated that HVEM Ig is able to exert a significant antiviral effect against HSV-1 infection in vivo.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close