Comparison

Recombinant Mouse Hepatitis A virus cellular receptor 2 homolog (Havcr2), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC26980-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Havcr2
Alternative Names
Hepatitis A virus cellular receptor 2 homolog, HAVcr-2, T-cell immunoglobulin and mucin domain-containing protein 3, T-cell immunoglobulin mucin receptor 3, T-cell membrane protein 3, Tim3, Timd3
Uniprot
Q8VIM0
Source
Mammalian cell
Expression Region
20-191aa
AA Sequence
RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWG KGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDL NKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKL ELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNG SETQTLVTLHNNNGTKISTWADEIKDSGETIR
Sequence Info
Extracellular Domain
Tag Info
C-terminal FC-tagged
Theoretical MW
46.3 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human Galectin 9 in functional ELISA is less than 20 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
T cell immunoglobulin and mucin domain-3 (TIM3), also called hepatitis A virus cellular receptor 2 (HAVCR2), is a transmembrane glycoprotein of the TIM family of immune regulating molecules and plays an important role in the Th1-mediated immune response. TIM3 is expressed on the Th1 cells, CD8 T-cells, monocytes, and dendritic cells, but not on Th2 cells. TIM3 expressed by monocytes and dendritic cells facilitates phagocytosis of apoptotic cells and up-regulates cross-presentation of apoptotic cell-associated antigens through interaction with phosphatidylserine. Engagement of TIM3 by its ligand galectin-9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity. Stimulation of TIM3 with an agonistic antibody promotes inflammation through the activation of innate immune cells. TIM3 is also regarded as a potential target molecule for immunotherapy. TIM3 and programmed cell death 1 (PD-1) as two important coinhibitory regulators of T cell responses, have been implicated with the T-cell dysfunction or exhaustion associated with chronic HBV infection including HBV-related HCC.
Function
Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand
Subcellular location
Isoform 1: Membrane, Single-pass type I membrane protein, Cell junction
Protein Families
Immunoglobulin superfamily, TIM family
Tissue Specificity
Expressed in T-helper type 1 lymphocytes. Not expressed by naive T-cells but up-regulated as they differentiate into T-helper-1 cells. Also expressed by differentiated type 1 CD8+ cytotoxic T-cells. Expressed on peritoneal exudate macrophages, monocytes, and splenic dendritic cells (DCs). Expression on natural killer (NK) cells is inversely associated with IFN-gamma production during the initial 24 h of LPS-induced endotoxic shock. Expressed on mast cells.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close