Comparison

Recombinant Mouse Leukocyte surface antigen CD47 (Cd47), partial (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC26981-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Cd47
Alternative Names
Leukocyte Surface Antigen CD47, Antigenic Surface Determinant Protein OA3, Integrin-Associated Protein, IAP, Protein MER6, CD47, MER6
Uniprot
Q61735-2
Source
Mammalian cell
Expression Region
19-158aa
AA Sequence
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEE MFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISV SDLINGIASLKMDKRDAMVGNYTCEVTELSREGKT VIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSP
Sequence Info
Partial of Isoform 2
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
16.7 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Mouse SIRPA in functional ELISA is less than 20 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
CD47, also known as Integrin?Associated Protein (IAP) and OA3, is a glycosylated atypical member of the immunoglobulin superfamily. Mouse CD47 is an integral membrane protein that consists of a extracellular domain (ECD) with a single Ig?like domain, five membrane-spanning regions with short intervening loops, and C?terminal cytoplasmic tail. CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. It plays an important role in memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, it binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cellcell adhesion, it enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. It may play a role in membrane transport and/or integrin dependent signal transduction. It also prevents premature elimination of red blood cells.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close