Comparison

Recombinant Mouse Glypican-1 (Gpc1) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC27022-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Gpc1
Alternative Names
Glypican-1, Gpc1
Uniprot
Q9QZF2
Source
Mammalian cell
Expression Region
24-529aa
AA Sequence
DPASKSRSCSEVRQIYGAKGFSLSDVPQAEISGEH LRICPQGYTCCTSEMEENLANHSRMELESALHDSS RALQATLATQLHGIDDHFQRLLNDSERTLQEAFPG AFGDLYTQNTRAFRDLYAELRLYYRGANLHLEETL AEFWARLLERLFKQLHPQLLPDDYLDCLGKQAEAL RPFGDAPRELRLRATRAFVAARSFVQGLGVASDVV RKVAQVPLAPECSRAIMKLVYCAHCRGVPGARPCP DYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKF WGPSGAESVIGGVHVWLAEAINALQDNKDTLTAKV IQACGNPKVNPHGSGPEEKRRRGKLALQEKPSTGT LEKLVSEAKAQLRDIQDFWISLPGTLCSEKMAMSP ASDDRCWNGISKGRYLPEVMGDGLANQINNPEVEV DITKPDMTIRQQIMQLKIMTNRLRGAYGGNDVDFQ DASDDGSGSGSGGGCPDDTCGRRVSKKSSSSRTPL THALPGLSEQEGQKTS
Sequence Info
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
56.7 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human FGFb in functional ELISA is less than 10 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Glypican-1 is a cell membrane protein and belongs to the glypican family. The protein may act as a catalyst in increasing the rate of conversion of prion protein PRPN(C) to PRNP(Sc) via associating (via the heparan sulfate side chains) with both forms of PRPN, targeting them to lipid rafts and facilitating their interaction. It is required for proper skeletal muscle differentiation by sequestering FGF2 in lipid rafts preventing its binding to receptors (FGFRs) and inhibiting the FGF-mediated signaling.
Function
Cell surface proteoglycan that bears heparan sulfate. Binds, via the heparan sulfate side chains, alpha-4 (V) collagen and participates in Schwann cell myelination (By similarity). May act as a catalyst in increasing the rate of conversion of prion protein PRPN(C) to PRNP(Sc) via associating (via the heparan sulfate side chains) with both forms of PRPN, targeting them to lipid rafts and facilitating their interaction. Required for proper skeletal muscle differentiation by sequestering FGF2 in lipid rafts preventing its binding to receptors (FGFRs) and inhibiting the FGF-mediated signaling. Binds Cu(2+) or Zn(2+) ions.
Subcellular location
Cell membrane, Lipid-anchor, GPI-anchor, Extracellular side, Endosome
Protein Families
Glypican family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close