Comparison

Recombinant Mouse Carbonic anhydrase 14 (Ca14), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC27024-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Ca14
Alternative Names
Carbonic Anhydrase 14, Carbonate Dehydratase XIV, Carbonic Anhydrase XIV, CA-XIV, CA14,
Uniprot
Q9WVT6
Source
Mammalian cell
Expression Region
16-290aa
AA Sequence
ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINI QTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHT VQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEG SEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQ GLAVLGILIEVGETENPAYDHILSRLHEIRYKDQK TSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSV LWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLV QNYRVPQPLNQRTIFASFIQAGPLYTTGEM
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
31.8 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
0.2 um filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The esterase activity is determined to be greater than 400 pmol/min/ug.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Mouse Ca14, also known as Carbonic anhydrase 14, is a member of large family of zinc metalloenzymes .It could catalyze reversible hydration of carbon dioxide. The reaction is fundamental to many processes such as respiration, renal tubular acidification and bone resorption. Fifteen CA isoforms have been reported so far. They have different patterns of tissue-specific expression and physiologic roles. Some CAs may serve as markers for tumors and hypoxia. CA XIV is a polypeptide consisting of an extracellular N-terminal catalytic domain, a membrane-spanning segment and a short intracellular C- terminal segment with several potential phosphorylation sites. A subset of CAs lack CA activity due to point mutations but retain esterase function. CA14 is widely expressed in the central nervous system
Function
Reversible hydration of carbon dioxide.
Subcellular location
Membrane, Single-pass type I membrane protein
Protein Families
Alpha-carbonic anhydrase family
Tissue Specificity
Most abundant in the kidney and heart, followed by the skeletal muscle, brain, lung and liver.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close