Comparison

Recombinant Mouse Sonic hedgehog protein (Shh), partial (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Mouse
Amount 50ug
Item no. BM-RPC27025-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
Shh
Alternative Names
Sonic Hedgehog Protein, SHH, HHG-1, SHH
Uniprot
Q62226
Source
E.coli
Expression Region
25-198aa
AA Sequence
CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGA SGRYEGKITRNSERFKELTPNYNPDIIFKDEENTG ADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGW DEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLAR LAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Sequence Info
Partial
Tag Info
Tag-Free
Theoretical MW
19.8 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, 1 mM DTT, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human BOC in functional ELISA is less than 90 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Mouse Sonic Hedgehog Homolog (SHH) belongs to a three-protein family called Hedgehog. The other two family members are Indian Hedgehog (IHH) and Desert Hedgehog (DHH). Hedgehog proteins are key signaling molecules in embryonic development. SHH is expressed in various embryonic tissues and plays critical roles in regulating the patterning of many systems, such as limbs and brain. SHH also plays an important role in adult, including the division of adult stem cells and the development of certain cancers and other diseases.Mouse Shh is synthesized as a 437 aa precursor that contains a 24 aa signal sequence and a 413 aa mature region. The mature region is autocatalytically processed into a nonglycosylated, 20 kDa, 174 aa N-terminal fragment (Shh-N), and a catalytic-processing, glycosylated, 34 kDa, 239 aa C-terminal fragment. The 20 kDa Shh-N fragment is the core of the active hedgehog molecule. Mouse Shh-N is 99%, 98%, and 100% aa identical to human, rat and gerbil Shh-N, respectively.
Function
Sonic hedgehog protein
Subcellular location
Sonic hedgehog protein N-product: Cell membrane, Lipid-anchor
Protein Families
Hedgehog family
Tissue Specificity
Expressed in a number of embryonic tissues including the notochord, ventral neural tube, floor plate, lung bud, zone of polarizing activity and posterior distal mesenchyme of limbs. In the adult, expressed in lung and neural retina.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close