« Back
Home /
Human recombinant IFN gamma protein, GMP

Human recombinant IFN gamma protein, GMP

Item no.	BOS-PROTP01579-10-1mg
Manufacturer	Boster
Amount	1 mg
Quantity options	100 ug 1 mg
Category	Neuroscience Neuroinflammation Cell Biology Cell Culture Cytokines ELISA Immunostaining Cell Culture
Format	Lyophilized
Applications	ELISA, Cell Culture
Specific against	Human (Homo sapiens)
Conjugate/Tag	HIS
Sequence	MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ with polyhistidine tag at the C-terminus.
Alias	Type II interferon,T-cell interferon,MAF
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 17.7 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Calculated Molecular weight	The protein has a calculated MW of 17.7 kDa.The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	IFNG
Purification	>95% as determined by SDS-PAGE analysis.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.
Description	The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.
Bioactivity/Biological Activity	Measure by its ability to induce cytotoxicity in HT29 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant human IFN gamma is approximately >2 x 10⁶ IU/mg, which is calibrated against the human IFN Gamma WHO Reference Material (NIBSC code: 87/586).
Endotoxin level	<0.05 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTP01579-10-1mg-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time