« Back
Home /
Human recombinant SCF protein, AF

Human recombinant SCF protein, AF

Item no.	BOS-PROTP21583-6-20ug
Manufacturer	Boster
Amount	20 ug
Quantity options	100 ug 20 ug 5 ug
Category	Cell Culture
Format	Lyophilized
Applications	Cell Culture
Specific against	Human (Homo sapiens)
Conjugate/Tag	HIS
Sequence	MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA with polyhistidine tag at the C-terminus
Alias	DCUA,DFNA69,FPH2,FPHH,KL-1,Kitl,MGF,SF,SHEP7,SLF,KIT ligand
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 19.4 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 19.4 kDa.The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	KITLG
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Stem Cell Factor (SCF) is a 166-amino-acid protein with a monomeric molecular weight of approximately 18.5 kDa. SCF is the ligand for the tyrosine kinase receptor c-kit, which regulates other Growth Factorss, such as granulocyte colony-stimulating factor (G-CSF), granulocyte macrophage-colony-stimulating factor (GM-CSF), and interleukin-3 to stimulate proliferation, and differentiation of hematopoietic stem cells. SCF can be produced by a variety of cells, including fibroblasts, smooth muscle, endothelial cells, mast cells and bone marrow macrophages endothelial cells.
Bioactivity/Biological Activity	Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <5 ng/mL. The specific activity of recombinant human SCF is > 5 x 10⁵ IU/mg.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTP21583-6-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time