« Back
Home /
Swine recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF

Swine recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF

Item no.	BOS-PROTP23563-1-20ug
Manufacturer	Boster
Amount	20 ug
Quantity options	20 ug 5 ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes By Cell Type Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Cell Culture
Format	Lyophilized
Applications	Cell Culture
Specific against	Pig (Porcine, Sus scrofa domesticus)
Conjugate/Tag	HIS
Sequence	MLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL with polyhistidine tag at the C-terminus.
Alias	TNFa,TNFSF2
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 18.1 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 18.1 kDa.The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	TNF
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Tumor necrosis factor alpha (TNF alpha) stimulates the acute phase of the immune response. In response to a pathogen, TNF alpha is one of the first to be released and can apply its effects in many organs. TNF alpha stimulates the release of corticotropic releasing hormone, suppresses appetite, and induces fever, in the hypothalamus. TNF increase vasodilation and loss of vascular permeability, it helps recruit lymphocyte, neutrophil, and monocyte to the inflammation site by regulating chemokine release.
Bioactivity/Biological Activity	Measure by its ability to induce cytotoxicity in PK15 cells in the presence of the actinomycin D. The ED₅₀ for this effect is <15 pg/mL.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTP23563-1-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time