Comparison

Recombinant Bovine Polymeric immunoglobulin receptor(PIGR),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Bovine
Amount 10ug
Host E.coli
Item no. CSB-EP017981BO-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P81265
Gene Names
PIGR
Organism
Bos taurus (Bovine)
AA Sequence
ESRGLIKEQYEGRLALLTEPGNGTYTVILNQLTDQ DTGFYWCVTDGDTRWISTVELKVVQGEPSLKVPKN VTAWLGEPLKLSCHFPCKFYSFEKYWCKWSNRGCS ALPTQNDGPSQAFVSCDQNSQVVSLNLDTVTKEDE GWYWCGVKEGPRYGETAAVYVAVESRVKGSQGAKQ VKAAPAGAAIQSRAGEIQNKALLDPS
Expression Region
399-599aa
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
MW
26.1 kDa
Relevance
This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the Extracellular domain (known as the secretory component) from the transmbrane segment.
Reference
Cloning and characterization of two forms of bovine polymeric immunoglobulin receptor cDNA.Kulseth M.A., Krajci P., Myklebost O., Rogne S.DNA Cell Biol. 14:251-256(1995)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €246.82
Price: €246.82
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close