Recombinant Bovine Selenoprotein P(SEPP1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Bovine
Amount 50ug
Host E.coli
Item no. CSB-EP021018BO-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P49907
Gene Names
SEPP1
Organism
Bos taurus (Bovine)
AA Sequence
ESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVAL LQASSYLCILQASRLEDLRVKLEKEGYSNISYVVV NHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVW TLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYV EDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATK EKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHH GHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHH RHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLSRK RCINQLLSQFPKDSESALSSCCCHCRHLVFEKTGS AITSQCTEKLPSLCSSQGLLAEENVIESSQSRLPP AASQAAGQQLNPTEASTKSSSKNKAKMSKSPSN
Expression Region
20-402aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
MW
70.1 kDa
Alternative Name(s)
Selenoprotein P-like protein
Relevance
Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells.
Reference
Molecular cloning of cDNA encoding a bovine selenoprotein P-like protein containing 12 selenocysteines and a (His-Pro) rich domain insertion, and its regional expression.Saijoh K., Saito N., Lee M.J., Fujii M., Kobayashi T., Sumino K.Brain Res. Mol. Brain Res. 30:301-311(1995)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €342.86
Price: €342.86
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close