Recombinant Bovine Pulmonary surfactant-associated protein B(SFTPB),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Bovine
Amount 10ug
Host E.coli
ArtNr CSB-EP021173BO1-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cell Biology
Uniprot ID
P15781
Gene Names
SFTPB
Organism
Bos taurus (Bovine)
AA Sequence
AAITYSLACAQGPEFWCQSLEQALQCRALGHCLQE VWGHVEADDLCQECENISRLLTKMAKEAIFQDSVR KFLEQECDVLPLKLLAPLCRHLLDTYFPLIIEHFQ SHMNPKFICQHVGLCKPRHPEPGKGPEPWGPLLDK LALPLLPGVPQAKPGPQTQDLSEQL
Expression Region
23-187aa
Sequence Info
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW
23.5 kDa
Alternative Name(s)
6KDA protein
Pulmonary surfactant-associated proteolipid SPL(Phe)
Relevance
Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Reference
"Characterization of the small hydrophobic proteins associated with pulmonary surfactant."
Yu S.-H., Chung W., Olafson R.W., Harding P.G.R., Possmayer F.
Biochim. Biophys. Acta 921:437-448(1987)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €224.38
Price: €224.38
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close