Recombinant Human Methylmalonyl-CoA mutase, mitochondrial(MUT)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP015243HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Signal Transduction
Target / Protein
MUT
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
P22033
AA Sequence
LHQQQPLHPEWAALAKKQLKGKNPEDLIWHTPEGI SIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTF RPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVA FDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKI LFDGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQG VPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKII ADIFEYTAKHMPKFNSISISGYHMQEAGADAILEL AYTLADGLEYSRTGLQAGLTIDEFAPRLSFFWGIG MNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLL RAHCQTSGWSLTEQDPYNNIVRTAIEAMAAVFGGT QSLHTNSFDEALGLPTVKSARIARNTQIIIQEESG IPKVADPWGGSYMMECLTNDVYDAALKLINEIEEM GGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIV GVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIK SSRDQALAERCLAALTECAASGDGNILALAVDASR ARCTVGEITDALKKVFGEHKANDRMVSGAYRQEFG ESKEITSAIKRVHKFMEREGRRPRLLVAKMGQDGH DRGAKVIATGFADLGFDVDIGPLFQTPREVAQQAV DADVHAVGISTLAAGHKTLVPELIKELNSLGRPDI LVMCGGVIPPQDYEFLFEVGVSNVFGPGTRIPKAA VQVLDDIEKCLEKKQQSV
Tag info
N-terminal 6xHis-tagged
Expression Region
33-750aa
Protein length
Full Length of Mature Protein
MW
84.8 kDa
Alternative Name(s)
Methylmalonyl-CoA isomerase
Relevance
Involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle. MCM has different functions in other species.
Reference
"An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
J. Proteomics 96:253-262(2014)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €162.50
Price: €162.50
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close