Recombinant Human Neurofilament heavy polypeptide(NEFH),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 50ug
Host E.coli
ArtNr CSB-EP015686HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
P12036
Gene Names
NEFH
Organism
Homo sapiens (Human)
AA Sequence
MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAG GTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGA ASSTDSLDTLSNGPEGCMVAVATSRSEKEQLQALN DRFAGYIDKVRQLEAHNRSLEGEAAALRQQQAGRS AMGELYEREVREMRGAVLRLGAARGQLRLEQEHLL EDIAHVRQRLDDEARQREEAEAAARALARFAQEAE AARVDLQKKAQALQEECGYLRRHHQEEVGELLGQI QGSGAAQAQMQAETRDALKCDVTSALREIRAQLEG HAVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRSAQ EEITEYRRQLQARTTELEALKSTKDSLERQRSELE DRHQADIASYQEAIQQLDAELRNTKWEMAAQLREY QDLLNVKMALDIEIAAYRKLLEGEECRI
Expression Region
1-413aa
Sequence Info
Partial
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW
65.6 kDa
Alternative Name(s)
200KDA neurofilament protein
Neurofilament triplet H protein
Relevance
Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber. NF-H has an important function in mature axons that is not subserved by the two smaller NF proteins.
Reference
"PKN associates and phosphorylates the head-rod domain of neurofilament protein."
Mukai H., Toshimori M., Shibata H., Kitagawa M., Shimakawa M., Miyahara M., Sunakawa H., Ono Y.
J. Biol. Chem. 271:9816-9822(1996)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €181.25
Price: €181.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close