Recombinant Human Merlin(NF2)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP015741HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cancer
Uniprot ID
P35240
Gene Names
NF2
Organism
Homo sapiens (Human)
AA Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEF NCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKD TVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENA EEELVQEITQHLFFLQVKKQILDEKIYCPPEASVL LASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVIN LYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKI AQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYD PENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKI DVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADS LEVQQMKAQAREEKARKQMERQRLAREKQMREEAE RTRDELERRLLQMKEEATMANEALMRSEETADLLA EKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLK QDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAP LPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEK VEYMEKSKHLQEQLNELKTEIEALKLKERETALDI LHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL
Expression Region
1-595aa
Sequence Info
Full Length
Tag Info
N-terminal 6xHis-tagged
MW
73.7 kDa
Alternative Name(s)
Moesin-ezrin-radixin-like protein
Neurofibromin-2
Schwannomerlin
Schwannomin
SCH
Relevance
Probable regulator of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in tumor suppression by restricting proliferation and promoting apoptosis. Along with WWC1 can synergistically induce the phosphorylation of LATS1 and LATS2 and can probably function in the regulation of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway. May act as a membrane stabilizing protein. May inhibit PI3 kinase by binding to AGAP2 and impairing its stimulating activity. Suppresses cell proliferation and tumorigenesis by inhibiting the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex.
Reference
"Alteration in a new gene encoding a putative membrane-organizing protein causes neuro-fibromatosis type 2."
Rouleau G.A., Merel P., Lutchman M., Sanson M., Zucman J., Marineau C., Hoang-Xuan K., Demczuk S., Desmaze C., Plougastel B., Pulst S., Lenoir G., Bijlsma E., Fashold R., Dumanski J.P., de Jong P., Parry D., Eldrige R. Thomas G.
Nature 363:515-521(1993)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €186.25
Price: €186.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close