Recombinant Human NF-kappa-B-repressing factor(NKRF),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP015836HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cell Biology
Uniprot ID
O15226
Gene Names
NKRF
Organism
Homo sapiens (Human)
AA Sequence
ILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCD GQNPPKKQAGSKFHARPRFEPVHFVASSSKDERQE DPYGPQTKEVNEQTHFASMPRDIYQDYTQDSFSIQ DGNSQYCDSSGFILTKDQPVTANMYFDSGNPAPST TSQQANSQSTPEPSPSQTFPESVVAEKQYFIEKLT ATIWKNLSNPEMTSGSDKINYTYMLTRCIQACKTN PEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQN IYLTTGYAGSKNGSRDRATELAVKLLQKRIEVRVV RRKFKHTFGEDLVVCQIGMSSYEFPPALKPPEDLV VLGKDASGQPIFNASAKHWTNFVITENANDAIGIL NNSASFNKMSIEYKYEMMPNRTWRCRVFLQDHCLA EGYGTKKTSKHAAADEALKILQKTQPTYPSVKSSQ CHTGSSPRGSGKKKDIKDLVVYENSSNPVCTLNDT AQFNRMTVEYVYERMTGLRWKCKVILESEVIAEAV GVKKTVKYEAAGEAVKTLKKTQPTVINNLKKGAVE DVISRNEIQGRSAEEAYKQQIKEDNIGNQLLRKMG WTGGGLGKSGEGIREPISVKEQHKREGLGLDVERV NKIAKRDIEQIIRNYARSESHTDLTFSRELTNDER KQIHQIAQKYGLKSKSHGVGHDRYLVVGRKRRKED LLDQLKQEGQVGHYELVMPQ
Expression Region
4-688aa
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
MW
81.1 kDa
Alternative Name(s)
Protein ITBA4Transcription factor NRF
Relevance
Interacts with a specific negative regulatory elent (NRE) 5'-AATTCCTCTGA-3' to mediate transcriptional repression of certain NK-kappa-B responsive genes. Involved in the constitutive silencing of the interferon beta promoter, independently of the virus-induced signals, and in the inhibition of the basal and cytokine-induced iNOS promoter activity. Also involved in the regulation of IL-8 transcription.
Reference
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close