Recombinant Human Glucocorticoid receptor(NR3C1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 50ug
Host E.coli
ArtNr CSB-EP016059HU1-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P04150
Gene Names
NR3C1
Organism
Homo sapiens (Human)
AA Sequence
VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDS TWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLD DQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAP DLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIK ELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVE NLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYS NGNIKKLLFHQK
Expression Region
521-777aa
Sequence Info
Partial
Tag Info
N-terminal 10xHis-GST-tagged
MW
59.8 kDa
Alternative Name(s)
Nuclear receptor subfamily 3 group C member 1
GRL
Relevance
Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling. Plays a role in rapid mRNA degradation by binding to the 5' UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth
Reference
"A new transcript splice variant of the human glucocorticoid receptor: identification and tissue distribution of hGR Delta 313-338, an alternative exon 2 transactivation domain isoform."
Turner J.D., Schote A.B., Keipes M., Muller C.P.
Ann. N. Y. Acad. Sci. 1095:334-341(2007)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €282.14
Price: €282.14
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close