Recombinant Human N-glycosylase/DNA lyase(OGG1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP016313HUa2-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cancer
Uniprot ID
O15527
Gene Names
OGG1
Organism
Homo sapiens (Human)
AA Sequence
MPARALLPRRMGHRTLASTPALWASIPCPRSELRL DLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTE EQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVT LAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIEC LFSFICSSNNNIARITGMVERLCQAFGPRLIQLDD VTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSA SARAILEEQGGLAWLQQLRESSYEEAHKALCILPG VGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYS WHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQ AVLFSADLRQSRHAQEPPAKRRKGSKGPEG
Expression Region
1-345aa
Sequence Info
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
54.8 kDa
Alternative Name(s)
Including the following 2 domains:
8-oxoguanine DNA glycosylase (EC:3.2.2.-)
DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18)
Short name:
AP lyase
Relevance
DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7, 8-dihydro-8-oxoguanine and 2, 6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.
Reference
"Cloning and characterization of mammalian 8-hydroxyguanine-specific DNA glycosylase/apurinic, apyrimidinic lyase, a functional mutM homologue."Aburatani H., Hippo Y., Ishida T., Takashima R., Matsuba C., Kodama T., Takao M., Yasui A., Yamamoto K., Asano M., Fukasawa K., Yoshinari T., Inoue H., Otsuka E., Nishimura S.Cancer Res. 57:2151-2156(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close