Recombinant Human Alpha-1-acid glycoprotein 2(ORM2)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 50ug
Host E.coli
ArtNr CSB-EP017238HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
P19652
Gene Names
ORM2
Organism
Homo sapiens (Human)
AA Sequence
QIPLCANLVPVPITNATLDRITGKWFYIASAFRNE EYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQN QCFYNSSYLNVQRENGTVSRYEGGREHVAHLLFLR DTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGE FYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKE RKQEEGES
Expression Region
19-201aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
MW
25.7 kDa
Alternative Name(s)
Orosomucoid-2 ; OMD 2
Relevance
Functions as transport protein in the blood stream. Binds various hydrophobic ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability. Appears to function in modulating the activity of the immune syst during the acute-phase reaction.
Reference
Structure and expression of the genes coding for human alpha 1-acid glycoprotein.Dente L., Pizza M.G., Metspalu A., Cortese R.EMBO J. 6:2289-2296(1987)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €181.25
Price: €181.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close