Comparison

Recombinant Human Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial(OXCT1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 50ug
Host E.coli
Item no. CSB-EP017306HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cancer
Uniprot ID
P55809
Gene Names
OXCT1
Organism
Homo sapiens (Human)
AA Sequence
TKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLI DALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIK RMVSSYVGENAEFERQYLSGELEVELTPQGTLAER IRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGS VAIASKPREVREFNGQHFILEEAITGDFALVKAWK ADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIV DIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSI RKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYA NLGIGIPLLASNFISPNITVHLQSENGVLGLGPYP RQHEADADLINAGKETVTILPGASFFSSDESFAMI RGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMG GAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLP LTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLT VDDVQKSTGCDFAVSPKLMPMQQIAN
Expression Region
40-520aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
MW
56.1 kDa
Alternative Name(s)
3-oxoacid CoA-transferase 1Somatic-type succinyl-CoA:3-oxoacid CoA-transferase ; SCOT-s
Relevance
Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.
Reference
Clinical and molecular characterization of five patients with succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency.Fukao T., Sass J.O., Kursula P., Thimm E., Wendel U., Ficicioglu C., Monastiri K., Guffon N., Baric I., Zabot M.T., Kondo N.Biochim. Biophys. Acta 1812:619-624(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close