Recombinant Human Pterin-4-alpha-carbinolamine dehydratase(PCBD1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 50ug
Host E.coli
ArtNr CSB-EP017514HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P61457
Gene Names
PCBD1
Organism
Homo sapiens (Human)
AA Sequence
AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFK QFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYN KVHITLSTHECAGLSERDINLASFIEQVAVSMT
Expression Region
2-104aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-GST-tagged
MW
41.9 kDa
Alternative Name(s)
4-alpha-hydroxy-tetrahydropterin dehydratase
Dimerization cofactor of hepatocyte nuclear factor 1-alpha
Relevance
Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.
Reference
"Phenylalanine hydroxylase-stimulating protein/pterin-4 alpha-carbinolamine dehydratase from rat and human liver. Purification, characterization, and complete amino acid sequence."
Hauer C.R., Rebrin I., Thoeny B., Neuheiser F., Curtius H.-C., Hunziker P., Blau N., Ghisla S., Heizmann C.W.
J. Biol. Chem. 268:4828-4831(1993)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €212.50
Price: €212.50
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close