Recombinant Human Protein disulfide-isomerase A3(PDIA3)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 50ug
Host E.coli
ArtNr CSB-EP017720HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P30101
Gene Names
PDIA3
Organism
Homo sapiens (Human)
AA Sequence
SDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGH CKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNK YGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLK KQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSF SEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDN GEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKK FIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDY EKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASR KTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQ EEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESN DGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHC KNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSP YEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISY LQREATNPPVIQEEKPKKKKKAQEDL
Expression Region
25-505aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW
59.3 kDa
Alternative Name(s)
58 kDa glucose-regulated protein
58 kDa microsomal protein
Relevance
Catalyzes the rearrangement of -S-S- bonds in proteins.
Reference
"ERp60 does not substitute for protein disulphide isomerase as the beta-subunit of prolyl 4-hydroxylase."
Koivunen P., Helaakoski T., Annunen P., Veijola J., Raeisaenen S., Pihlajaniemi T., Kivirikko K.I.
Biochem. J. 316:599-605(1996)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €282.14
Price: €282.14
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close